PIFO_MOUSE Q9D9W1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D9W1
Recommended name：Protein pitchfork
EC number：
Alternative names：
Cleaved into：
GeneID：100503311
Gene names (primary )：Pifo
Gene names (synonym )：
Gene names (ORF )：
Length：207
Mass：23434
Sequence：MNTEEIPVAPPLRGVTPALQWKVNNYSFGTRQARKLFPHYHPPTWLGNLYLPLRGMPHTGPGCYAAATDWNGLAYNLSKVPTSTKGYAIGARTAVRFKPISKDVTPYPGMYQKVDTLSEKHKKSFAPFNILMPRFRSAAKGDSYPGPGTYNPEMKSVPKVTWPMKFGSPDWSQVPCLEKRTLKAELSADKDFRKHRSRVAYFSLYYQ
Tissue specificity：Expressed in tissues rich in ciliated cells, such as lung, kidney, vas deferens and testis. Both isoforms 1 and 2 are expressed in testis. {ECO:0000269|PubMed:20643351}.
Induction：
Developmental stage：At 7.75 dpc, expression restricted to the ventral node monociliated pit cells. Not expressed in other tissues at detectable levels until 9.5 dpc. At 10.5 dpc, expressed in motor neurons in the ventral neural tube and in the apical ectodermal ridge of lim buds. {ECO:0000269|PubMed:20643351}.
Protein families：