FEZF1_MOUSE Q0VDQ9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q0VDQ9
Recommended name：Fez family zinc finger protein 1
EC number：
Alternative names：
Cleaved into：
GeneID：73191
Gene names (primary )：Fezf1
Gene names (synonym )：Fez
Gene names (ORF )：
Length：475
Mass：52006
Sequence：MDSSCLNATTKMLATAPARGNVMSTSKPLAFSIERIMARTPEPKALPVPHFLQGAVPKGDPKHSLHLNSSIPCMIPFVPVAYDTNSKAGVNGSEPRKASLEVPAPPAVAPSAPAFSCSDLLNCALSLKGDLARDALPLQQYKLVRPRVVNHSSFHAMGALCYLNRGDGPCHPAASVNIHPVASYFLSSPLHPQPKTYLAERNKLVVPAVEKLPSGVAFKDLSQAQLQHYMKESAQLLSEKIAFKTSDFSRGSPNAKPKVFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHTRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQFKCNICNKAFHQVYNLTFHMHTHNDKKPFTCPTCGKGFCRNFDLKKHVRKLHDSSLGLTRTPTGEPSSDPPPQLQQPPPAPLPPLQPTLPPPGPLPSGLHQGHQ
Tissue specificity：
Induction：
Developmental stage：At 8.0 dpc expressed in prospective forebrain region. At 12.5 dpc, detected in the olfactory epithelium, septum, roof of the telencephalon, amygdala, prethalamus and hypothalamus. Expression was barely detected in the vomeronasal organs at 12.5 dpc. At 15.5 dpc, detected weakly in the olfactory epithelium, amygdala and hypothalamusat 15.5 dpc. Expression was not detected in the olfactory bulb or in the ganglionic eminences, where the interneuron progenitors of the olfactory bulb are generated. {ECO:0000269|PubMed:10781957, ECO:0000269|PubMed:16540508}.
Protein families：Krueppel C2H2-type zinc-finger protein family