GLT11_MOUSE   Q921L8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q921L8

Recommended name:Polypeptide N-acetylgalactosaminyltransferase 11

EC number:EC 2.4.1.41

Alternative names:(Polypeptide GalNAc transferase 11) (GalNAc-T11) (pp-GaNTase 11) (Protein-UDP acetylgalactosaminyltransferase 11) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 11)

Cleaved into:

GeneID:231050

Gene names  (primary ):Galnt11

Gene names  (synonym ):

Gene names  (ORF ):

Length:608

Mass:69201

Sequence:MGSITVRYFCYGCLFTSATWTVLLFIYFNFSEVTQPLRNVPIKGSGPHGPFPKKFYPRFTRGPGRVLDPQFKANRIDRLMNNHIEDPDKGLSKSSSELGMIFNERDQELRDLGYQKHAFNMLISNRLGYHRDVPDTRNAECRRKSYPTDLPTASIVICFYNEAFSALLRTVHSVVDRTPAHLLHEIILVDDSSDFDDLKGELDEYIQRYLPAKVKVIRNMKREGLIRGRMIGAAHATGEVLVFLDSHCEVNVMWLQPLLAIILEDPHTVVCPVIDIISADTLAYSSSPVVRGGFNWGLHFKWDLVPVSELGGPDGATAPIRSPTMAGGLFAMNRQYFNDLGQYDSGMDIWGGENLEISFRIWMCGGKLFILPCSRVGHIFRKRRPYGSPEGQDTMTHNSLRLAHVWLDEYKEQYFSLRPDLKNKSFGNISERVELRKKLGCQSFKWYLDNIYPEMQIPGPNAKPQQPVLINRGPKRPRVLQRGRLYHLQTNKCLVAQGRSSQKGGLVLLKTCDYGDPTQVWIYNEDHELILNNLLCLDMSETRSSDPPRLMKCHGSGGSQQWTFGKNNRLYQVSVGQCLRVMDLMDQKGYVGMAICDGSSSQQWRLEG

Tissue specificity:Mainly expressed in kidney. Weakly expressed in other tissues. {ECO:0000269|PubMed:11925450}.

Induction:

Developmental stage:At 8.0 dpc, present in the left-right organiser (LRO) node, with enrichment in crown cells compared to pit cells (at protein level). {ECO:0000269|PubMed:24226769}.

Protein families:Glycosyltransferase 2 family, GalNAc-T subfamily


   💬 WhatsApp