TACC3_MOUSE Q9JJ11
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JJ11
Recommended name：Transforming acidic coiled-coil-containing protein 3
EC number：
Alternative names：(ARNT-interacting protein)
Cleaved into：
GeneID：
Gene names (primary )：Tacc3
Gene names (synonym )：Aint
Gene names (ORF )：
Length：631
Mass：70627
Sequence：MSLHVLNDENVPNEKSSQCRDFQFLPPELTGRSSVLCLSQKENVPPQSQAKATNVTFQTPPRDPQTHRILSPNMTNKREAPFGLQNDHCVFLQKENQRPLAPVDDAPVVQMAAEILRAEGELQEGILTSSSLSASTSLLDSELVTPPIEPVLEPSHQGLEPVLESELVTPPVEPVLEPSHQELEPVLESELVTPPIEPVLEPSHQGLEPVLDSELVTPPIEPVLEPSHQGLEPVLESELVTPPIEPVLEPSHQGLEPVLDSELVTPPIEPVLEPSHQGLEPVLDSELVTPPIEPLLEPSHQGLEPVVDLKEESFRDPSEVLGTGAEVDYLEQFGTSSFKESAWRKQSLYVKFDPLLKDSPLRPMPVAPITNSTQDTEEESGSGKPTEAELVNLDFLGDLDVPVSAPTPVWSLEPRGLLPAEPIVDVLKYSQKDLDAVVNVMQQENLELKSKYEDLNTKYLEMGKSVDEFEKIAYKSLEEAEKQRELKEIAEDKIQKVLKERDQLNADLNSMEKSFSDLFKRFEKRKEVIEGYQKNEESLKKYVGECIVKIEKEGQRYQALKIHAEEKLRLANEEIAQVHSKAQAEVLALQASLRKAQMQNHSLEMTLEQKTKEIDELTRICDDLISKMEKI
Tissue specificity：Embryonically expressed.
Induction：
Developmental stage：At 9 dpc, the expression is strong in the neuroepithelium of neural tube and in placenta. At 13 dpc, the expression is still observed in neuroepithelium. Furthermore, strong expression is seen in lung, kidney, intestines, thymus and liver, and a moderate signal is detected in the cartilage primordium of developing ribs, tooth and eye. By 17 dpc, the tissue distribution changes so that no signal is detected in the liver and the signal has diminished in other organs. It is observed for the first time in the salivary gland, thyroid gland and brown fat and was strong in the thymus, eye, olfactory epithelium and central nervous system. At 1.5 days after birth, the expression is still strong in thymus, but weaker and more limited in brain.
Protein families：TACC family