LMCD1_MOUSE   Q8VEE1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8VEE1

Recommended name:LIM and cysteine-rich domains protein 1

EC number:

Alternative names:

Cleaved into:

GeneID:30937

Gene names  (primary ):Lmcd1

Gene names  (synonym ):

Gene names  (ORF ):

Length:365

Mass:40996

Sequence:MAKVAKDLNPGVQKMSLGQQQSARGVACLRCKGMCSGFEPHSWRKICKSCKCSQEEHCLSSDLDDDRKIGRLLMDSKYATLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKERQPVTGTEGALYRRRQLMHQLPIYDQDPSRCRGLVENELKAMEEFVKHYKSEALGVGEVALPGQGGLPKEENKTQEKPEGTETTAPTTNGSLGDPSKEVEYVCELCKGAAPVDSPVVYADRAGYSKQWHPTCFQCIKCSEPLVDLIYFWKDGAPWCGRHYCESVRPRCSGCDEIIFSEDYQRVEDLAWHRKHFICEGCEQLLSGRAYIVTKGQLLCPTCSKSKRS

Tissue specificity:Expressed in distal airway epithelium of the lung, vascular smooth muscle, and myocardium. {ECO:0000269|PubMed:16199866}.

Induction:

Developmental stage:At 9.5 dpc expressed in the myocardium and forming anterior foregut epithelium. By 12.5 dpc, expression is observed in the airways of the developing lung as well as in the myocardium. At 14.5 dpc, when proximal-distal differentiation in the lung is proceeding rapidly, expression is observed at high levels in the distal but not proximal airways of the developing lung. By 16.5 dpc, expression decreases in airway epithelium in the lung and expression is also observed in the vascular smooth muscle of pulmonary arteries (at protein level). {ECO:0000269|PubMed:16199866}.

Protein families:


   💬 WhatsApp