RSLAB_MOUSE   Q5SSG5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5SSG5

Recommended name:Ras-like protein family member 10B

EC number:EC 3.6.5.2

Alternative names:

Cleaved into:

GeneID:276952

Gene names  (primary ):Rasl10b

Gene names  (synonym ):

Gene names  (ORF ):

Length:203

Mass:23229

Sequence:MVSTYRVAVLGARGVGKSAIVRQFLYNEFSEVCVPTTTRRLYLPAVVMNGHVHDLQILDFPPISAFPVNTLQEWADACCRGLRSVHAYILVYDICCFDSFEYVKTIRQQILETRVIGTSETPIIIVGNKRDLQRGRVIPRWNVSHLVRKTWKCGYVECSAKYNWHILLLFSELLKSVGCARCKHVHAALRFQGALRRNRCAIM

Tissue specificity:Expressed in heart and brain. In the brain, expression restricted to neurons of the cortex, hippocampus and cerebellum. Sparse expression in the brainstem and almost absent in the hypothalamic region. In the heart, expressed in cardiomyocytes. Not detected in interstitial tissue or vascular cells. {ECO:0000269|PubMed:17984325}.

Induction:

Developmental stage:At 9.5 dpc, detected in the developing heart, skeletal myotomes and dorsal portion of the neural tube. At 13.5 and 15.5 dpc, expressed in the heart and neural tissue including the central and peripheral nervous system. In the embryonic brain, expression is restricted to more mature neurons and absent from the progenitor neuronal cells of the ventricular zone. Also present in mature peripheral neurons, such as the neurons of the dorsal root ganglia and the Auerbach's and Meissner's plexi of the intestinal tract. {ECO:0000269|PubMed:17984325}.

Protein families:Small GTPase superfamily, Ras family


   💬 WhatsApp