MYOZ1_MOUSE Q9JK37
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JK37
Recommended name：Myozenin-1
EC number：
Alternative names：(Calsarcin-2) (Filamin-, actinin- and telethonin-binding protein) (Protein FATZ)
Cleaved into：
GeneID：59011
Gene names (primary )：Myoz1
Gene names (synonym )：
Gene names (ORF )：
Length：296
Mass：31457
Sequence：MPLSGTPAPNKRRKSSKLIMELTGGGRESSGLNLGKKISVPRDVMLEELSLLTNRGSKMFKLRQMRVEKFIYENHPDVFSDSSMDHFQKFLPTVGGQLETAGQGFSYGKGSSGGQAGSSGSAGQYGSDRHQQGSGFGAGGSGGPGGQAGGGGAPGTVGLGEPGSGDQAGGDGKHVTVFKTYISPWDRAMGVDPQQKVELGIDLLAYGAKAELPKYKSFNRTAMPYGGYEKASKRMTFQMPKFDLGPLLSEPLVLYNQNLSNRPSFNRTPIPWLSSGEHVDYNVDVGIPLDGETEEL
Tissue specificity：Expressed primarily in skeletal muscle and specifically enriched in the gastrocnemius, which is composed predominantly of fast-twitch muscle fibers. Detected at lower levels in heart. {ECO:0000269|PubMed:10984498, ECO:0000269|PubMed:11114196}.
Induction：
Developmental stage：At 9.5 dpc, expressed at significant levels in cardiac muscle with lower levels detected in skeletal muscle of tongue. At 15.5 dpc, cardiac expression is down-regulated and only weakly detected in atria, whereas skeletal muscle expression is more robust. {ECO:0000269|PubMed:11114196}.
Protein families：Myozenin family