CEBPB_MOUSE P28033
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P28033
Recommended name:CCAAT/enhancer-binding protein beta
EC number:
Alternative names:(C/EBP beta) (AGP/EBP) (Interleukin-6-dependent-binding protein) (IL-6DBP) (Liver-enriched transcriptional activator) (LAP)
Cleaved into:
GeneID:12608
Gene names (primary ):Cebpb
Gene names (synonym ):
Gene names (ORF ):
Length:296
Mass:31446
Sequence:MHRLLAWDAACLPPPPAAFRPMEVANFYYEPDCLAYGAKAARAAPRAPAAEPAIGEHERAIDFSPYLEPLAPAADFAAPAPAHHDFLSDLFADDYGAKPSKKPADYGYVSLGRAGAKAAPPACFPPPPPAALKAEPGFEPADCKRADDAPAMAAGFPFALRAYLGYQATPSGSSGSLSTSSSSSPPGTPSPADAKAAPAACFAGPPAAPAKAKAKKTVDKLSDEYKMRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASAGHC
Tissue specificity:Abundantly expressed in myoblasts. Enriched in brown adipose tissue (BAT) versus white adipose tissue (WAT). Expressed in hepatocytes (at protein level). Expressed in T lymphocytes (PubMed:16585579). The expression in granulosa cells of antral follicles is induced by luteinizing hormone (PubMed:9303532). Expressed in chondrocytes and osteoblasts (at protein level) (PubMed:19440205). {ECO:0000269|PubMed:10635333, ECO:0000269|PubMed:16585579, ECO:0000269|PubMed:19440205, ECO:0000269|PubMed:19641492, ECO:0000269|PubMed:9303532}.
Induction:Up-regulated by cold exposure. {ECO:0000269|PubMed:19641492}.
Developmental stage:At 9.5 dpc, expressed in the chorionic plate and ectoplacental cone. From 10.5 dpc to at least 11.5 dpc, is also expressed in the trophoblast cells of the three placenta layers (PubMed:15509779). Expressed in monocytic precursors but is vanished during differentiation into osteoclasts. The expression increases during osteoblast differentiation (PubMed:19440205). {ECO:0000269|PubMed:15509779, ECO:0000269|PubMed:19440205}.
Protein families:BZIP family, C/EBP subfamily