VAX1_MOUSE Q2NKI2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q2NKI2
Recommended name：Ventral anterior homeobox 1
EC number：
Alternative names：
Cleaved into：
GeneID：22326
Gene names (primary )：Vax1
Gene names (synonym )：
Gene names (ORF )：
Length：338
Mass：35167
Sequence：MFGKPDKMDVRCHSDTEAARVSKNAHKESREIKGAEGSLPAAFLKEPQGAFSGSGASEDCNKSKSNSSADPDYCRRILVRDAKGSIREIILPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQGKDSELRSVVSETAATCSVLRLLEQGRLLSPPGLPALLPPCATGALGSALRGPSLPALGAGAAAGSAAAAAAAAAATAPGPAGAASQHQPAVGGAPGPGPAGPGGLHAGAPTASHGLFSLPVPSLLGSVASRLSSAPLTMAGSLAGNLQELSARYLSSSAFEPYSRTNNKEGAEKKALD
Tissue specificity：
Induction：
Developmental stage：At 9.5 dpc, expressed in the forebrain, through the optic stalk and ending in the proximal portion of the optic vesicle. At 10.5 dpc, expressed in the optic stalk, outer layer of the optic cup, and the primordium of the pigment epithelium. In the pigment epithelium, down-regulated after 11.5 dpc, and expression restricted to the optic stalk and the ventral forebrain. {ECO:0000269|PubMed:10421837, ECO:0000269|PubMed:9636075}.
Protein families：EMX homeobox family