RECO_MOUSE P34057
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P34057
Recommended name：Recoverin
EC number：
Alternative names：(23 kDa photoreceptor cell-specific protein) (Cancer-associated retinopathy protein) (Protein CAR)
Cleaved into：
GeneID：19674
Gene names (primary )：Rcvrn
Gene names (synonym )：Rcv1
Gene names (ORF )：
Length：202
Mass：23407
Sequence：MGNSKSGALSKEILEELQLNTKFTEEELSAWYQSFLKECPSGRITRQEFESIYSKFFPDSDPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTTAGKPTQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMIKPEDVKLLPDDENTPEKRAEKIWAFFGKKEDDKLTEEEFIEGTLANKEILRLIQFEPQKVKERIKEKKQ
Tissue specificity：Expressed in rod photoreceptors in the retina (at protein level). {ECO:0000269|PubMed:1386025, ECO:0000269|PubMed:15882641, ECO:0000269|PubMed:15961391}.
Induction：
Developmental stage：At postnatal day 11 abundantly expressed in the retina outer plexiform layer, outer nuclear layer, and outer limiting membrane, with weak expression in the inner nuclear layer and inner plexiform layer (PubMed:28151698). At postnatal day 22 abundantly expressed in the retina inner nuclear layer, outer plexiform layer, outer nuclear layer, outer limiting membrane, outer segment, and inner segment (PubMed:28151698). {ECO:0000269|PubMed:28151698}.
Protein families：Recoverin family