LFTY2_MOUSE P57785
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P57785
Recommended name：Left-right determination factor 2
EC number：
Alternative names：(Left-right determination factor B) (Protein lefty-2) (Protein lefty-B)
Cleaved into：
GeneID：320202
Gene names (primary )：Lefty2
Gene names (synonym )：Leftb
Gene names (ORF )：
Length：368
Mass：41175
Sequence：MKSLWLCWALWVLPLAGPGAAMTEEQVLSSLLQQLQLSQAPTLDSADVEEMAIPTHVRSQYVALLQGSHADRSRGKRFSQNFREVAGRFLMSETSTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPRTALRRFERLSPHSARARVTIEWLRVREDGSNRTALIDSRLVSIHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPGTWSAHKLVRFAAQGTPDGKGQGEPQLELHTLDLKDYGAQGNCDPEVPVTEGTRCCRQEMYLDLQGMKWAENWILEPPGFLTYECVGSCLQLPESLTIGWPFLGPRQCVASEMTSLPMIVSVKEGGRTRPQVVSLPNMRVQTCSCASDGALIPRGIDL
Tissue specificity：
Induction：
Developmental stage：At the primitive streak stage (7.0 dpc), expressed in the emerging mesoderm. By 8.0 dpc, expressed exclusively on the left side of developing embryos with expression predominantly in the lateral-plate mesoderm (LPM). Weak expression in the prospective floor plate (PFP).
Protein families：TGF-beta family