EGR2_MOUSE P08152
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P08152
Recommended name:E3 SUMO-protein ligase EGR2
EC number:EC 2.3.2.-
Alternative names:(E3 SUMO-protein transferase ERG2) (Early growth response protein 2) (EGR-2) (Zinc finger protein Krox-20)
Cleaved into:
GeneID:13654
Gene names (primary ):Egr2
Gene names (synonym ):Egr-2 Krox-20 Zfp-25
Gene names (ORF ):
Length:470
Mass:49819
Sequence:MMTAKAVDKIPVTLSGFMHQLPDSLYPVEDLAASSVTIFPNGELGGPFDQMNGVAGDGMINIDMTGEKRPLDLPYPSSFAPISAPRNQTFTYMGKFSIDPQYPGASCYPEGIINIVSAGILQGVTPPASTTASSSVTSASPNPLATGPLGVCTMSQTQPELDHLYSPPPPPPPYSGCTGDLYQDPSAFLSPPSTTSTSSLAYQPPPSYPSPKPAMDPGLIPMIPDYPGFFPSPCQRDPHGAAGPDRKPFPCPLDSLRVPPPLTPLSTIRNFTLGGPGAGVTGPGASGGGEGPRLPGSGSAAVTATPYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSAPPSAQSSASGPGGSQAGGSLCGNSAIGGPLASCTSRTRTP
Tissue specificity:Expressed mainly in the thymus. {ECO:0000269|PubMed:17938205}.
Induction:Activated during G0/G1 transition in cultured cells. {ECO:0000269|PubMed:3129290}.
Developmental stage:Before 8 dpc, expressed in the future rhombomere r3 at 0-3 somites, followed by expression in rhombomere r5 in 4-7 somites at 8 dpc, and maintained until 12 somites (PubMed:8093858). Expressed in migrating neural crest cells from r5/r6 (PubMed:8093858). Expressed in boundary cap cells that surround nerve exit points from the central nervous system at 10.5 dpc (PubMed:7935840, PubMed:8093858). Up to 14.5 dpc, expressed in motor and sensory roots of cranial and spinal nerves (PubMed:7935840). After 15.5 dpc, expressed in the entire peripheral nervous system (PubMed:7935840). Expressed in the embryonic nervous system (PubMed:17938205). Expressed in myelinating Schwann cells 2 weeks after birth (PubMed:7935840). {ECO:0000269|PubMed:17938205, ECO:0000269|PubMed:7935840, ECO:0000269|PubMed:8093858}.
Protein families:EGR C2H2-type zinc-finger protein family