PCS1N_MOUSE Q9QXV0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QXV0
Recommended name：ProSAAS
EC number：
Alternative names：(IA-4) (Proprotein convertase subtilisin/kexin type 1 inhibitor) (Proprotein convertase 1 inhibitor) (pro-SAAS)
Cleaved into：KEP; Big SAAS (b-SAAS); Little SAAS (l-SAAS); Big PEN-LEN (b-PEN-LEN) (SAAS CT(1-49)); PEN; PEN-20; PEN-19; Little LEN (l-LEN); Big LEN (b-LEN) (SAAS CT(25-40))
GeneID：30052
Gene names (primary )：Pcsk1n
Gene names (synonym )：
Gene names (ORF )：
Length：258
Mass：27270
Sequence：MAGSPLLCGPRAGGVGILVLLLLGLLRLPPTLSARPVKEPRSLSAASAPLVETSTPLRLRRAVPRGEAAGAVQELARALAHLLEAERQERARAEAQEAEDQQARVLAQLLRAWGSPRASDPPLAPDDDPDAPAAQLARALLRARLDPAALAAQLVPAPAAAPRPRPPVYDDGPTGPDVEDAGDETPDVDPELLRYLLGRILTGSSEPEAAPAPRRLRRSVDQDLGPEVPPENVLGALLRVKRLENPSPQAPARRLLPP
Tissue specificity：Expressed in brain (mostly hypothalamus and pituitary) and gut. Expressed in trigeminal ganglia and neuroendocrine cell lines. PEN is expressed in pancreas, spinal cord and brain (most abundant in striatum, hippocampus, pons and medulla, and cortex) (at protein level). {ECO:0000269|PubMed:10632593, ECO:0000269|PubMed:11259501, ECO:0000269|PubMed:16631141, ECO:0000269|PubMed:9630436}.
Induction：
Developmental stage：Broadly expressed from 9 dpc to 11 dpc, with some enrichment in neural tube-derived tissues. By 15 dpc, the expression is largely restricted to neuroendocrine tissues. {ECO:0000269|PubMed:15018810}.
Protein families：