ITBP2_MOUSE Q9R000
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9R000
Recommended name：Integrin beta-1-binding protein 2
EC number：
Alternative names：(Melusin)
Cleaved into：
GeneID：26549
Gene names (primary )：Itgb1bp2
Gene names (synonym )：
Gene names (ORF )：
Length：350
Mass：38768
Sequence：MSLLCYNKGCGQHFDPNTNLPDSCRYHPGVPIFHDALKGWSCCRKRTVDFSEFLNIKGCTVGLHCAEKLPEVPPQPEGPATSSLQEQKPLNTIPKSAETLFRERPKSEMPPKLLPLLISQALGVALEQKELDQEPGAGLDNSLIWTGSSCQNPGCDAVYQGPESDATPCTYHPGAPRFHEGMKSWSCCGIQTLDFGAFLAQPGCRVGRHDWAKQLPASCRHDWHQTDSVVVLTVYGQIPLPAFNWVKASQTELHVHIVFDGNRVFQAQMKLWGVINVEQSSVSLMPSRVEISLVKADPGSWAQLEHPDSLAEKARAGVLLEMDEEESEDSDDDLSWTEEEDEEEEEAMGE
Tissue specificity：Expressed in skeletal and cardiac muscles but not in other tissues. Is localized in rows flanking the Z line containing alpha-actinin.
Induction：During muscle regeneration.
Developmental stage：Detectable in embryo limbs at day 15, reached a maximum in newborn, and declined in adult limb muscles. During heart development level remains steady from embryonic day 15 to adult stage.
Protein families：