PR7B1_MOUSE   Q8CGZ9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8CGZ9

Recommended name:Prolactin-7B1

EC number:

Alternative names:(Placental prolactin-like protein N) (PLP-N) (PRL-like protein N)

Cleaved into:

GeneID:75596

Gene names  (primary ):Prl7b1

Gene names  (synonym ):Prlpn

Gene names  (ORF ):

Length:251

Mass:28960

Sequence:MNTSLTQLCFWALQILLMSNLLLWEDVVSVPTIGSGSGVSEMLTEDLFDDAIILSQHINSLAIETRRIFLSNNFSSDMFITFTLQFNRHDEFVVNGLNSCHTLPLKSPKTEKEAKRISLPDFMNMILSILRAWDNPLHHMETELKSMPGAPFAILARVKDIEVKNKILLDRIMKIAKKVKYGFEENEVYPAWSELASLQSANEESRFFALYKLSYCLFVDTDKVEHYLKHLKCRYFDGYMCQDSVNQINLL

Tissue specificity:Expression restricted to placenta. Abundantly expressed in trophoblast cells of the junctional zone and trophoblasts migrating into the mesometrial decidua. {ECO:0000269|PubMed:12488360}.

Induction:

Developmental stage:Detectable throughout the second half of gestation. {ECO:0000269|PubMed:12488360}.

Protein families:Somatotropin/prolactin family


   💬 WhatsApp