C10_MOUSE O35127
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35127
Recommended name：Protein C10
EC number：
Alternative names：
Cleaved into：
GeneID：14790
Gene names (primary )：Grcc10
Gene names (synonym )：C10
Gene names (ORF )：
Length：126
Mass：13194
Sequence：MASASAQPAALSAEQAKVVLAEVIQAFSAPENAVRMDEARDNACNDMGKMLQFVLPVATQIQQEVIKAYGFSCDGEGVLKFARLVKSYEAQDPEIASLSGKLKALFLPPMTLPPHGPASGSSVAAS
Tissue specificity：Ubiquitously expressed, with higher expression in lung. {ECO:0000269|PubMed:23453665}.
Induction：
Developmental stage：Detected as early as 10.5 dpc. {ECO:0000269|PubMed:23453665}.
Protein families：UPF0456 family