TAFA1_MOUSE Q7TPG8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q7TPG8
Recommended name：Chemokine-like protein TAFA-1
EC number：
Alternative names：
Cleaved into：
GeneID：320265
Gene names (primary )：Tafa1
Gene names (synonym )：Fam19a1
Gene names (ORF )：
Length：133
Mass：14873
Sequence：MAMVSAMSWALYLWISACAMLLCHGSLQHTFQQHHLHRPEGGTCEVIAAHRCCNKNRIEERSQTVKCSCLPGKVAGTTRNRPSCVDASIVIGKWWCEMEPCLEGEECKTLPDNSGWMCATGNKIKTTRIHPRT
Tissue specificity：Expressed in the hippocampus and detected also in the cortex (at protein level). {ECO:0000269|PubMed:29799787}.
Induction：Expression decreases upon brain injury. {ECO:0000269|PubMed:29799787}.
Developmental stage：Detected as early as 12.5 dpc, expression peaks between postnatal day 1 and day 7 and decreases at week 8 after birth (at protein level). {ECO:0000269|PubMed:29799787}.
Protein families：TAFA family