MEIG1_MOUSE Q61845
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q61845
Recommended name：Meiosis-expressed gene 1 protein
EC number：
Alternative names：(Protein expressed in male leptotene and zygotene spermatocytes 278) (MLZ-278)
Cleaved into：
GeneID：104362
Gene names (primary )：Meig1
Gene names (synonym )：Meg1
Gene names (ORF )：
Length：88
Mass：10823
Sequence：MATSDVKPKSISRAKKWSEEIENLYRFQQAGYRDEIEYKQVKQVAMVDRWPETGYVKKLQRRDNTFFYYNKERECEDKEVHKVKVYVY
Tissue specificity：Several isoforms have been identified differing in their 5'-untranslated exons. These isoforms show different tissue expression. Some are expressed in various tissues, including lung, liver, brain, testis, oviduct and oocytes. Some are testis-specific. {ECO:0000269|PubMed:1390336, ECO:0000269|PubMed:19805151, ECO:0000269|PubMed:20339383}.
Induction：
Developmental stage：Detected as early as 6 days after birth and up-regulated during spermatogenesis. {ECO:0000269|PubMed:1390336, ECO:0000269|PubMed:19805151, ECO:0000269|PubMed:20339383}.
Protein families：MEIG1 family