EGLN3_MOUSE Q91UZ4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91UZ4
Recommended name:Prolyl hydroxylase EGLN3
EC number:EC 1.14.11.-
Alternative names:(Egl nine homolog 3) (Hypoxia-inducible factor prolyl hydroxylase 3) (HIF-PH3) (HIF-prolyl hydroxylase 3) (HPH-3) (Prolyl hydroxylase domain-containing protein 3) (PHD3) (SM-20)
Cleaved into:
GeneID:112407
Gene names (primary ):Egln3
Gene names (synonym ):
Gene names (ORF ):
Length:239
Mass:27302
Sequence:MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHYNGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAINFLLSLIDRLVLYCGSRLGKYYVKERSKAMVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGVLRIFPEGKSFVADVEPIFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALAKD
Tissue specificity:Highly expressed in cardiac and smooth muscle. Also high expression in brain, skeletal muscle and kidney. Low levels in lung. {ECO:0000269|PubMed:12234095}.
Induction:Induced by hypoxia. Up-regulated in proliferating myoblasts induced to form differentiated myotubes. {ECO:0000269|PubMed:21317538}.
Developmental stage:Detected at 8.5 dpc in proliferating myoblasts of the dermomyotome and the developing heart tube. From dermomyotomal cells of the rostral somites expression progressed in a rostral to caudal pattern, with highest levels seen in the muscle primordia and mature muscles. {ECO:0000269|PubMed:10543731}.
Protein families: