ISLR_MOUSE   Q6GU68


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6GU68

Recommended name:Immunoglobulin superfamily containing leucine-rich repeat protein

EC number:

Alternative names:

Cleaved into:

GeneID:26968

Gene names  (primary ):Islr

Gene names  (synonym ):

Gene names  (ORF ):

Length:428

Mass:45615

Sequence:MRALCLLCWAVLLNLVRACPEPCDCGEKYGFQIADCAYRDLEGVPPGFPANVTTLSLSANRLPGLPEGAFREVPLLQSLWLAHNEIRSVAIGALAPLSHLKSLDLSHNLLSEFAWSDLHNLSALQLLKMDSNELAFIPRDAFSSLSALRSLQLNHNRLHALAEGTFAPLTALSHLQINDNPFDCTCGIVWFKTWALASAVSIPEQDNIACTTPHVLKGIPLGRLPPLPCSAPSVQLSYQPSQDGAELRPGFVLALHCDVDGQPVPQLHWHIHTPGGTVEIASPNVGTDGRALPGALATSGQPRFQAFANGSLLIPDFGKLEEGTYSCLATNELGSAESSVNVALATPGEGGEDAVGHKFHGKAVEGKGCYTVDNEVQPSGPEDNVVIIYLSRAGPPEAAIAADGRPAQQFSGILLLGQSLLVLSFFYF

Tissue specificity:Detected in thyroid, heart, retina and spinal cord. {ECO:0000269|PubMed:10512678}.

Induction:

Developmental stage:Detected at all stages of development and more abundant in the latter period. {ECO:0000269|PubMed:10512678}.

Protein families:


   💬 WhatsApp