NATD1_MOUSE Q9DBW3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9DBW3
Recommended name：Protein NATD1
EC number：
Alternative names：(Gene trap locus protein F3-2) (Gene trap locus protein F3b) (N-acetyltransferase domain-containing protein 1)
Cleaved into：
GeneID：24083
Gene names (primary )：Natd1
Gene names (synonym )：Gm16515 Gtlf3b
Gene names (ORF )：
Length：110
Mass：12731
Sequence：MAHATPPSALEQGGPIRVEHDRQRRQFSVRLNGCHDRAVLLYEYVGKRIVDLQHTEVPDAYRGRGIAKHLAKAALDFVVEEDLKAHLTCWYIQKYVKENPLPQYLERLQP
Tissue specificity：Expressed in the heart, testis, kidney and lung. {ECO:0000269|PubMed:10402672}.
Induction：
Developmental stage：Detected at multiple sites in embryonic day 10.5 embryos, including the genital ridges, the aortic endothelium and endothelium-associated cell clusters within the aortic lumen. {ECO:0000269|PubMed:10402672}.
Protein families：NATD1 family