O1509_MOUSE Q7TQQ0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q7TQQ0
Recommended name：Olfactory receptor 1509
EC number：
Alternative names：(Odorant receptor 244-3) (Odorant receptor 83)
Cleaved into：
GeneID：57271
Gene names (primary )：Olfr1509
Gene names (synonym )：MOR244-3 MOR83
Gene names (ORF )：
Length：308
Mass：34986
Sequence：MGALNQTRVTEFIFLGLTDNWVLEILFFVPFTVTYMLTLLGNFLIVVTIVFTPRLHNPMYFFLSNLSFIDICHSSVTVPKMLEGLLLERKTISFDNCIAQLFFLHLFACSEIFLLTIMAYDRYVAICIPLHYSNVMNMKVCVQLVFALWLGGTIHSLVQTFLTIRLPYCGPNIIDSYFCDVPPVIKLACTDTYLTGILIVSNSGTISLVCFLALVTSYTVILFSLRKQSAEGRRKALSTCSAHFMVVALFFGPCIFLYTRPDSSFSIDKVVSVFYTVVTPLLNPLIYTLRNEEVKTAMKHLRQRRICS
Tissue specificity：Expressed in olfactory epithelium, specifically in the olfactory sensory neurons of the septal organ. {ECO:0000269|PubMed:10493742, ECO:0000269|PubMed:18214836, ECO:0000269|PubMed:22328155}.
Induction：
Developmental stage：Detected at very low levels at 18 dpc and increased to its maximum level of expression by 7 days after birth in olfactory sensory neurons of the septal organ. {ECO:0000269|PubMed:18214836}.
Protein families：G-protein coupled receptor 1 family