DHSO_MOUSE Q64442
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64442
Recommended name：Sorbitol dehydrogenase
EC number：EC 1.1.1.-
Alternative names：(SDH) (SORD) (L-iditol 2-dehydrogenase) (Polyol dehydrogenase) (Xylitol dehydrogenase) (XDH) (EC 1.1.1.9)
Cleaved into：
GeneID：20322
Gene names (primary )：Sord
Gene names (synonym )：Sdh1
Gene names (ORF )：
Length：357
Mass：38249
Sequence：MAAPAKGENLSLVVHGPGDIRLENYPIPELGPNDVLLKMHSVGICGSDVHYWEHGRIGDFVVKKPMVLGHEAAGTVTKVGELVKHLKPGDRVAIEPGVPREVDEYCKIGRYNLTPTIFFCATPPDDGNLCRFYKHNADFCYKLPDSVTFEEGALIEPLSVGIYACRRGSVSLGNKVLVCGAGPVGMVTLLVAKAMGAAQVVVTDLSASRLTKAKEVGADFTIQVGKETPQEIASKVESLLGSKPEVTIECTGAESSVQTGIYATHSGGTLVIVGMGAEMVNLPLVHAAIREVDIKGVFRYCNTWPMAISMLASKTLNVKPLVTHRFPLEKAVEAFETAKKGVGLKVMIKCDPNDQNP
Tissue specificity：Testis has the highest level of expression, followed by kidney, liver, and lung. Low levels of expression are also observed in lens, brain, and skeletal muscle. Expressed in sperm flagellum and very low expression in the sperm head. {ECO:0000269|PubMed:18799757, ECO:0000269|PubMed:6852349, ECO:0000269|PubMed:7601136}.
Induction：
Developmental stage：Detected early in spermatogenesis. Detected in condensing spermatids (at protein level) and is up-regulated during late spermatogenesis. {ECO:0000269|PubMed:18799757}.
Protein families：Zinc-containing alcohol dehydrogenase family