SYT15_MOUSE   Q8C6N3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8C6N3

Recommended name:Synaptotagmin-15

EC number:

Alternative names:(Synaptotagmin XV) (SytXV)

Cleaved into:

GeneID:319508

Gene names  (primary ):Syt15

Gene names  (synonym ):

Gene names  (ORF ):

Length:418

Mass:47270

Sequence:MAEQLAFLIGGIIGGLLLLIGVSCCLWRRFCATFTYEELPETSDPATISYFSRKEDRLYQYSGTPPGRLPSVPFVVPPSHQGRDWVPLHGGDWAVAPQDPCPVPEHMACTSSAKPGDACEMGSINPELYKSPEDTSETGFPDGCLGRLWFSVEYQQESERLLVGLIKAQQLQVPSETCSTLVKLHLLPDERRFLQSKTKHKICNPQFDENFIFQVSSKSVTQRVLKFSVYHVNKKRKHQLLGQVLFPLKNETLAGDHHRIIWRDLEAKNLEPPSEFGDIQFCLSYNDYLSRLTVVVLRAKGLQLQEDRSVVSVFVKVSLMNHNKFVKCKRTSAVLGSVNPVYNETFSFKVDTNELDTASLSLVVLQTTEGNKSSPLGRVVVGPYMYTRGKELEHWGEMLRKPKELVKRWHALCRPTEP

Tissue specificity:Isoform 1 and isoform 2 are expressed in heart, lung, skeletal muscle and testis; not detected in brain, liver and kidney. Isoform 1 is expressed in spleen. {ECO:0000269|PubMed:12788067}.

Induction:

Developmental stage:Detected from 7 dpc. {ECO:0000269|PubMed:12788067}.

Protein families:Synaptotagmin family


   💬 WhatsApp