CNMD_MOUSE Q9Z1F6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z1F6
Recommended name：Leukocyte cell-derived chemotaxin 1
EC number：
Alternative names：(Chondromodulin)
Cleaved into：Chondrosurfactant protein (CH-SP); Chondromodulin-1 (Chondromodulin-I) (ChM-I)
GeneID：16840
Gene names (primary )：Cnmd
Gene names (synonym )：Chmi Lect1
Gene names (ORF )：
Length：334
Mass：37225
Sequence：MTENSDKVPITMVGPEDVEFCSPPAYTTVTVKPSGSPTRLLKVGAVVLISGAVLLLFGAIGAFYFWKGNDNHIYNVHYSMSINGKLQDGSMEIDAVNNLETFKMGSGAEEAIEVNDFKNGITGIRFAGGEKCYIKAQVKARIPEVGTVTKQSISELEGKIMPANYEENSLIWVAVDQPVKDSSFLSSKILELCGDLPIFWLKPMYPKEIQRERREVVRNSAPSTTRRPHSEPRGNAGPGRLSNGTRPNVQDDAEPFNPDNPYHQQEGESMTFDPRLDHEGICCIECRRSYTHCQKICEPLGGYYPWPYNYQGCRSACRVVMPCSWWVARILGMV
Tissue specificity：Detected in the four cardiac valves, valvular interstitial cells and extracellular matrix (at protein level). {ECO:0000269|PubMed:16980969}.
Induction：
Developmental stage：Detected from 9.5 dpc in the cardiac valve precursor cells from the atrioventricular cushions and outflow. At 10 dpc expressed in the cardiac jelly covering the trabeculating cardiomyocytes of the left ventricle, the outer curvature of the right ventricle and the outflow tract. Expression in the ventricles decreased gradually as development progressed, and disappeared by mid-embryogenesis (at protein level). {ECO:0000269|PubMed:16980969}.
Protein families：Chondromodulin-1 family