CCD87_MOUSE Q8CDL9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8CDL9
Recommended name：Coiled-coil domain-containing protein 87
EC number：
Alternative names：
Cleaved into：
GeneID：399599
Gene names (primary )：Ccdc87
Gene names (synonym )：
Gene names (ORF )：
Length：855
Mass：98467
Sequence：MEPHSQEPDLKPIYHRLLSPLSLFPSKAKPPPEPPKRPSQDATPLQSIPLAKLKVGPLCRQVSKRLASSGRAARVTAKDRLRLTEVILEELKCNWREPPIEPILDYENNQKLRQRLESYVLISSEQLFVRYLHLLVTLPTSRRVFTESATLSRLAVNLARDCTVFLTSPDVYRCLLADFQTLLNLKHAQGGIVKLRPPPCPPGTFKLCPIPWPHSTGLDHMPCSSLNLNYLVQLSRPYDFPSEPEPDPVEELKSIPQLKSRQQLLWVPSMIKDKEIESRPSPMVPLPSHSPSSESHQFPTSPVHSWLQRGQSMPCLHEGWSLADELCLLPPSPHPLTPLILASESKPLPFRDIVAEDLKQKMKIMRMEWSRYSLLDSGLPPLLGVLTRRLTAQHHLEKLQQMIKSLQEEEASGKWDLQPPRIIPLHPQPVTVALKVHDQVIVQVATVQLSERYFNDSFHVEGAGVLYNHLTGELDGKAIEEMDADRLVGNTTGEVYKELMSRVSVSHLSFEEGDQIEPSADKDWSSYLASSFLHQDKHMPIINRNLVGFYSRRTSTPKPVPEKVPSLTLLPRHKSWDKRPNRHGVWMNWLKPSVSSEDYFKYLSFQESDFLHVIFQMYEKEAPVEVPVPVQEYLDIQQPPPLLQDEELEFMQGKWDWSSVIEDGSGPGRAYIHNLQQRLKRLWVMLEVPEQNRLDMVIKYSSNARLQQLPALIKAWEQVLKPIQKRESLLGRLEWFEQQASDPNRFFQKPDLLMNRLLEENRFRSYLQRKLNRMESNLVSLLERIESVFGEPVTFKGRSYLKKMKQDKVEMLYWLQQQRRIRNLTQAQKTFRQSCTFTGSSSQALVAPGNTPTTH
Tissue specificity：Specifically expressed in testis (at protein level). Not detected in other tissues tested (at protein level). In the testis, localizes to pachytene spermatocytes and spermatids. {ECO:0000269|PubMed:29733332}.
Induction：
Developmental stage：Detected from postnatal day 14 onwards. Maintained at high levels through to adulthood. {ECO:0000269|PubMed:29733332}.
Protein families：CCDC87 family