MORN2_MOUSE Q6UL01
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6UL01
Recommended name：MORN repeat-containing protein 2
EC number：
Alternative names：(MORN motif protein in testis)
Cleaved into：
GeneID：378462
Gene names (primary )：Morn2
Gene names (synonym )：Mopt
Gene names (ORF )：
Length：79
Mass：8897
Sequence：MNGFGRLEHFSGAVYEGQFKDNMFHGLGTYTFPTGAKYTGNFNENRVEGEGEYTDTQGLQWCGNFHFTAAPGLKLKLYM
Tissue specificity：Expressed strongly in testis, where it is specifically detected in haploid germ cells (at protein level). Also expressed strongly in skeletal muscle. {ECO:0000269|PubMed:19913896}.
Induction：
Developmental stage：Detected from postnatal day 15 onwards, with high levels of expression by postnatal day 28. {ECO:0000269|PubMed:19913896}.
Protein families：