TBC21_MOUSE Q9D9D3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D9D3
Recommended name：TBC1 domain family member 21
EC number：
Alternative names：(Male germ cell Rab GTPase-activating protein)
Cleaved into：
GeneID：74286
Gene names (primary )：Tbc1d21
Gene names (synonym )：MgcRabGAP
Gene names (ORF )：
Length：336
Mass：39261
Sequence：MTTLSPENSLSARRSATFILEKRNPPIDKAEWDSFFDENGHLAKSRDFICINILERGLHPFVRTEAWKFLTGYYSWQSSRDERLMVDSNRRRNYNSLCQMYEKIQPLLENLHGNFTETRNNIAYDIQRLYDKDPLGNVLIDKKKLEKTLLLSYVCNTKAEYQRGFHEMVMLFQLMVEHDHETFWLFQFFLQKTEHSCVINIGVGKNLDMLNSLITLLDPEFAEHLKGKGSGAVQSLFPWFCLCFQRAFKTFDDVWRLWEVLLTGKPCRNFQVLVAYSMLQMVREQALLECMSGDAILMACNNLIDLDADELISAACVVYSELMQKEVPQPLKEFLL
Tissue specificity：Expressed in testis, specifically in elongating and elongated spermatids (at protein level). {ECO:0000269|PubMed:21128978}.
Induction：
Developmental stage：Detected from postnatal day 35 onward. {ECO:0000269|PubMed:21128978}.
Protein families：