NET5_MOUSE   Q3UQ22


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3UQ22

Recommended name:Netrin-5

EC number:

Alternative names:(Netrin-1-like protein)

Cleaved into:

GeneID:243967

Gene names  (primary ):Ntn5

Gene names  (synonym ):Gm484

Gene names  (ORF ):

Length:452

Mass:48837

Sequence:MTDYRTLFSSPGAGSTVTTPITLSLLLLLSQATSDPCYDPGGRPRFCLPPVTQLVGKAAAPCSQTCALPAASPGPACNSSLTLDLDGSFLLTSVTLRFCTAGPPALVLSAAWATGGPWRPLWRRPAWPGALGGPKKVTFHSPPGPKTRIVASYLRVEFGGKAGLVTTGVRGRCQCHGHAARCATRAQPPRCRCRHHTTGPGCESCRPSHRDWPWRPATPQHPHPCLPCQCHPIGATGGMCNQTSGQCSCKLGVTGLTCNRCGPGYQQSRSPRMPCQRIPEATTTPATTPVASRSDPQCQGYCNVSVSSVHMSLQRYCQQDYVLHAQVSASSSQPSEAVGPEWWRLAVHVLAVFKQRAWPVRRGGQEAWVPRADLICGCLRLRPGADYLLLGRAAQTHDDDNYDPARLILNRHGLALPWRPRWARPLRRLQQKERGGACRGLLPPTRSPGPRN

Tissue specificity:

Induction:

Developmental stage:Detected in boundary cap cells at 11.5 dpc, expression is strongest between 15.5 and 17.5 dpc and is barely detectable at birth. {ECO:0000269|PubMed:26858598}.

Protein families:


   💬 WhatsApp