TM50B_MOUSE Q9D1X9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D1X9
Recommended name：Transmembrane protein 50B
EC number：
Alternative names：
Cleaved into：
GeneID：77975
Gene names (primary )：Tmem50b
Gene names (synonym )：
Gene names (ORF )：
Length：158
Mass：17948
Sequence：MAGFLDNFRWPECECIDWSERRNTVASVVAGILFFTGWWIMIDAAVVYPKPEQLNHAFHTCGVFSTLAFFMINAVSNAQVRGDSYESGCLGRTGARVWLFIGFMLMFGSLIASMWILFGAYVTQNIDVYPGLAVFFQNALIFFSTLIYKFGRTEELWA
Tissue specificity：Expressed in brain, heart and testis (at protein level). In the cerebellum, has particularly strong expression in Bergmann astroglial cells (at protein level). {ECO:0000269|PubMed:18541381}.
Induction：
Developmental stage：Detected in cortical plate, trigeminal ganglion, dorsal root ganglia and the spinal cord at embryonic stage 14.5 dpc. Widely expressed in brain at postnatal day 7 including cortex, olfactory bulb, hippocampus and cerebellum. Expressed throughout layers II-VI of the cortex. In the olfactory bulb, has strongest expression in glomerular and mitral cell layers. In hippocampus, localizes to CA1, CA2, CA3 and dentate gyrus regions. In cerebellum, mainly expressed in the internal granule cell layer and the Purkinje cell layer. {ECO:0000269|PubMed:18541381}.
Protein families：UPF0220 family