CLD10_MOUSE Q9Z0S6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z0S6
Recommended name：Claudin-10
EC number：
Alternative names：
Cleaved into：
GeneID：58187
Gene names (primary )：Cldn10
Gene names (synonym )：Cldn10a
Gene names (ORF )：
Length：231
Mass：24695
Sequence：MASTALEIVAFVVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYFANLWKICVTDSTGVANCKEFPSMLALDGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDQAKAKIACLAGIVFILSGLCSMTGCSLYANKITTEFFDPLYMEQKYELGAALFIGWAGASLCIIGGVIFCFSISDNNKTPRMGYTYNGPTSAMSSRTKYQGGEGDFKTTGPSKQFDKNAYV
Tissue specificity：Strong expression detected in brain cortex and kidney and weak expression in lung and cecum. In kidney, detected in thick ascending limb (TAL) of Henle's loop and proximal convoluted tubule (PCT). Isoform 1 is widely expressed, with highest expression detected in brain cortex, kidney and lung. Isoform 2, isoform 3, isoform 4 and isoform 5 are only detected in kidney and uterus. In kidney, the expression of isoform 1 is highest in medulla, with transcripts being detected in medullary thick ascending limb of Henle's loop (mTAL) and outer and inner medullary collecting ducts, whereas isoform 2 (along with isoform 4) is more highly expressed in cortex, with transcripts being detected in PCT, mTAL and cortical collecting duct. Expressed in the inner ear where it is detected in organ of Corti, marginal cells of stria vascularis, Reissner's membrane and spiral limbus (at protein level) (PubMed:14698084). Expressed in salivary glands and skin (PubMed:28771254). {ECO:0000269|PubMed:14698084, ECO:0000269|PubMed:16804102, ECO:0000269|PubMed:19383724, ECO:0000269|PubMed:22891322, ECO:0000269|PubMed:28771254}.
Induction：
Developmental stage：Detected in developing kidney at 14 dpc, with levels increasing towards adulthood. Expressed during tooth development: at 12 dpc, detected in the thickening tooth epithelium, at 13.5 dpc in the lingual basal epithelium of the bud epithelium, at 14.5 dpc in lingual epithelium and between 18 dpc to postnatal day 1 in odontoblasts and stratum intermedium. {ECO:0000269|PubMed:16520537, ECO:0000269|PubMed:17075866}.
Protein families：Claudin family