JAM3_MOUSE Q9D8B7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D8B7
Recommended name：Junctional adhesion molecule C
EC number：
Alternative names：(JAM-C) (JAM-2) (Junctional adhesion molecule 3) (JAM-3)
Cleaved into：Soluble form of JAM-C (sJAM-C)
GeneID：83964
Gene names (primary )：Jam3
Gene names (synonym )：
Gene names (ORF )：
Length：310
Mass：34838
Sequence：MALSRRLRLRLYARLPDFFLLLLFRGCMIEAVNLKSSNRNPVVHEFESVELSCIITDSQTSDPRIEWKKIQDGQTTYVYFDNKIQGDLAGRTDVFGKTSLRIWNVTRSDSAIYRCEVVALNDRKEVDEITIELIVQVKPVTPVCRIPAAVPVGKTATLQCQESEGYPRPHYSWYRNDVPLPTDSRANPRFQNSSFHVNSETGTLVFNAVHKDDSGQYYCIASNDAGAARCEGQDMEVYDLNIAGIIGGVLVVLIVLAVITMGICCAYRRGCFISSKQDGESYKSPGKHDGVNYIRTSEEGDFRHKSSFVI
Tissue specificity：Colocalizes with Jam2 near the lumen of seminiferous tubulues. Detected at junctional plaques that correspond to cell-cell contacts between spermatids and Sertoli cells (PubMed:15372036, PubMed:28617811). Detected on endothelial cells, in brain vessels and kidney glomeruli (at protein level) (PubMed:11053409, PubMed:11739175). Detected in heart, lung, liver, kidney, testis, thymus, lymph node and Peyer patch (PubMed:11053409, PubMed:11739175). Endothelial cells (PubMed:11739175). {ECO:0000269|PubMed:11053409, ECO:0000269|PubMed:11739175, ECO:0000269|PubMed:15372036, ECO:0000269|PubMed:28617811}.
Induction：
Developmental stage：Detected in diploid pre-meiotic spermatocytes, haploid spermatids and elongated spermatids (PubMed:28617811, PubMed:15372036). Restricted to junctional plaques in the heads of elongated spermatids (at protein level) (PubMed:15372036). {ECO:0000269|PubMed:15372036, ECO:0000269|PubMed:28617811}.
Protein families：Immunoglobulin superfamily