TSYL1_MOUSE O88852
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88852
Recommended name：Testis-specific Y-encoded-like protein 1
EC number：
Alternative names：(TSPY-like protein 1)
Cleaved into：
GeneID：22110
Gene names (primary )：Tspyl1
Gene names (synonym )：Tspyl
Gene names (ORF )：
Length：379
Mass：42994
Sequence：MSSPERDEGTPVPDSRGHCDADTVSGTPDRRPLLGEEKAVTGEGRAGIVGSPAPRDVEGLVPQIRVAAARQGESPPSVRGPAAAVFVTPKYVEKAQETRGAESQARDVKTEPGTVAAAAEKSEVATPGSEEVMEVEQKPAGEEMEMLEASGGVREAPEEAGPWHLGIDLRRNPLEAIQLELDTVNAQADRAFQHLEQKFGRMRRHYLERRNYIIQNIPGFWMTAFRNHPQLSAMIRGRDAEMLRYVTSLEVKELRHPKTGCKFKFFFRRNPYFRNKLIVKEYEVRSSGRVVSLSTPIIWRRGHEPQSFIRRNQDLICSFFTWFSDHSLPESDRIAEIIKEDLWPNPLQYYLCREGIRRPRRRPIREPVEIPRPFGFQSG
Tissue specificity：Highly expressed in testis, ovary, liver, spleen, brain, kidney, prostate, lung, and heart. Low expression in liver. {ECO:0000269|PubMed:9730615}.
Induction：
Developmental stage：Detected in embryo at 10.5 dpc. {ECO:0000269|PubMed:9730615}.
Protein families：Nucleosome assembly protein (NAP) family