EDAD_MOUSE Q8VHX2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8VHX2
Recommended name：Ectodysplasin-A receptor-associated adapter protein
EC number：
Alternative names：(EDAR-associated death domain protein) (Protein crinkled)
Cleaved into：
GeneID：
Gene names (primary )：Edaradd
Gene names (synonym )：Cr
Gene names (ORF )：
Length：208
Mass：23753
Sequence：MASPDDPLRSDHMAKEPVEDTDPSTLSFAMSDKYPIQDTGLPKAKECDTVNSNCPPNSDDQPQGEENDFPDSTKDPLSGVSRNQPCKDRKGSCSCPSCSPRAPTISDLLNDQDLLDTIRIKLDPCHPTVKNWRNFASKWGMPYDELCFLEQRPQSPTLEFLFRNSQRTVGQLMELCRLYHRADVEKILRRWVDEEWPHRGHSDSSMHF
Tissue specificity：
Induction：
Developmental stage：Detected in embryonic skin (12.5 dpc and 14.5 dpc) during the formation of hair follicles and at 15.5 dpc in the enamel knot of the developing tooth. Detected in the basal layer of the epidermis and hair follicles of P2 mice.
Protein families：