ABHD2_MOUSE Q9QXM0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QXM0
Recommended name：Monoacylglycerol lipase ABHD2
EC number：EC 3.1.1.23
Alternative names：(2-arachidonoylglycerol hydrolase) (Abhydrolase domain-containing protein 2) (Acetylesterase) (Lung alpha/beta hydrolase 2) (MmLABH2) (Triacylglycerol lipase) (EC 3.1.1.79)
Cleaved into：
GeneID：54608
Gene names (primary )：Abhd2
Gene names (synonym )：Labh-2 Labh2
Gene names (ORF )：
Length：425
Mass：48378
Sequence：MNAMLETPELPAVFDGVKLAAVAAVLYVIVRCLNLKSPTAPPDLYFQDSGLSRFLLKSCPLLTKEYIPPLIWGKSGHIQTALYGKMGRVRSPHPYGHRKFITMSDGATSTFDLFEPLAEHCVGDDITMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYGCTWEFGAMVNYIKRTYPQTQLVVVGFSLGGNIVCKYLGETQANQEKVLCCVSVCQGYSALRAQETFMQWDQCRRFYNFLMADNMKKIILSHRQALFGDHVKKPQSLEDTDLSRLYTATSLMQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHESLLTIPKSLSEKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQWERNKSQCSDTEQMEAELE
Tissue specificity：Widely expressed with higher expression in testis. Expressed by vascular smooth muscle cells, non vascular smooth muscle cells and heart. {ECO:0000269|PubMed:11922611, ECO:0000269|PubMed:15721306}.
Induction：
Developmental stage：Detected in embryos from 7 dpc to 17 dpc. Weakly expressed in heart at 9.5 dpc. Expression is detected in endothelial cells of the dorsal aorta at 10.5 dpc and disappear at 12.5 dpc. Expression in smooth muscle cells is first detected at 11.5 dpc. Strongly expressed in vitelline vessels at 12.5 dpc. Expressed in all smooth muscle cells at 16.5 dpc. {ECO:0000269|PubMed:11922611, ECO:0000269|PubMed:15721306}.
Protein families：AB hydrolase superfamily, AB hydrolase 4 family