SMAP1_MOUSE   Q91VZ6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q91VZ6

Recommended name:Stromal membrane-associated protein 1

EC number:

Alternative names:

Cleaved into:

GeneID:98366

Gene names  (primary ):Smap1

Gene names  (synonym ):

Gene names  (ORF ):

Length:440

Mass:47660

Sequence:MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTPEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIRDKYEKKKYYDKNAIAITNKEKEKKKDEKKREKEPEKPAKPLTTEKLPKKEEQQLEPKKSTSPKNAAEPTIDLLGLDGPAEAPVTNGNPATAPALSDDLDIFGPMISNPLPAAVMPPAQGTASVPAPATLSTVTSGDLDLFTEQTTKSEEVAKKQLSKDSILSLYGTGAQQSTPGVFMGPTNIPFTSQAPTAFQGFPSMGVPVPAAPGLIGNMMGQNTGMMVGMPMHNGFMGNAQTGVMPLPQNVVGPQGGMVGQMGAPQSKFGLPQAQQPQWNLSQMNQQMAAMNLSSANASAGFGQPPSTTAGWSGSSSGQTLSTQLWK

Tissue specificity:Detected in adult brain, lung, heart, liver, ovary and bone marrow. Detected in stromal cells of the red pulp of adult spleen. {ECO:0000269|PubMed:9644265}.

Induction:

Developmental stage:Detected in stromal cells of fetal liver at 10.5 days. Expression was maximal after 14 days of development and decreased thereafter. Detected at low levels after 18 days. {ECO:0000269|PubMed:9644265}.

Protein families:


   💬 WhatsApp