RFX2_MOUSE   P48379


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P48379

Recommended name:DNA-binding protein RFX2

EC number:

Alternative names:(Regulatory factor X 2)

Cleaved into:

GeneID:19725

Gene names  (primary ):Rfx2

Gene names  (synonym ):

Gene names  (ORF ):

Length:717

Mass:79190

Sequence:MQNSEGGADSPASVALRPAAQPMPASPQRVLVQAAGSTPKGTPMQTLTLPRVQPVPPQVQHVYPAQVQYVEGGDAVYANGAIRAAYAYNPDPQLYAPSSAASYFETPGGTQVTVAASSPPAVPSHGMVGITMDVSGTPIVSGAGAYLIHGGMDGTRHSLAHTARSSPATLEMAIETLQKSEGLAPHKGGLLNSHLQWLLDNYETAEGVSLPRSSLYNHYLRHCQEHKLEPVNAASFGKLIRSVFMGLRTRRLGTRGNSKYHYYGIRLKPDSPLNRLQEDTQYMAMRQQPTHQKPRYRPAQKSDSLGDGSAHSNMHGMPDQAMATQGQHHQQYIDVSHVFPEFPAPDLGSTLLQESVTLHDVKALQLVYRRHCEATLDVVMNLQFQYIEKLWLSFWNCKATSSDSCASLPASDEDPEVTLLPKEKLISLCKCEPILQWMRSCDHILYQTLVETLIPDVLRPVPSSLTQAIRNFAKSLEGWLINAMSGFPQQVIQTKVGVVSAFAQTLRRYTSLNHLAQAARAVLQNTSQINQMLSDLNRVDFANVQEQASWVCQCEESLVQRLEHDFKVTLQQQSSLDQWASWLDNVVTQVLKQHSGSPSFPKAARQFLLKWSFYSSMVIRDLTLRSAASFGSFHLIRLLYDEYMFYLVEHRVAQATGETPIAVMGEFNDLASLSLTLLDKEDIGDGHSSEADVDGRSLGEPLVKRERSDPSHPLQGI

Tissue specificity:

Induction:

Developmental stage:Detected in the anterior primitive streak preceding the morphological appearance of the node at 7.0 dpc. Expressed in the node and in the midline notochordal plate cells extending anteriorly from the node at 7.5 dpc. At 8.5 dpc, expressed in the node now located in the tail region. At 9.5 dpc, detected in the floor plate and in the dorsal portion of the neural tube, with highest expression in the anterior portion of the spinal cord. Also expressed in the developing gut. At 10.5 dpc, also observed in the telencephalon region of the brain and in the anterior portion of the limb bud at 12.5 dpc (PubMed:26248850). Localizes to cells at the posterior margin of the ciliated organ of asymmetry (PubMed:22233545). {ECO:0000269|PubMed:22233545, ECO:0000269|PubMed:26248850}.

Protein families:RFX family


   💬 WhatsApp