ZFP41_MOUSE Q02526
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q02526
Recommended name：Zinc finger protein 41
EC number：
Alternative names：(Zfp-41) (CtFIN92)
Cleaved into：
GeneID：22701
Gene names (primary )：Zfp41
Gene names (synonym )：Zfp-41
Gene names (ORF )：
Length：198
Mass：22724
Sequence：MEKPATRKKKSQAPKEEAGAQKATVKGEKTSKGKKATKKPRKPRRPRKEPVLSPEDEAHIFDAFDASFKDDFEGVPVFVPFQRKKPYECGECGRIFKHKTDHIRHQRVHTGEKPFKCDQCGKTFRHSSDVTKHQRIHTGEKPFKCGECGKAFNCGSNLLKHQKTHTGEKPYGCEECGKSFAYSSCLIRHRKRHPRKKH
Tissue specificity：Predominantly in the spermatocytes and spermatids of testes. It is also expressed in the fetus and embryonic stem cells at lower levels. {ECO:0000269|PubMed:1397691}.
Induction：
Developmental stage：Detected in the newborn testis and peaks at 3 weeks during the first cycle of spermatogenesis. Expressed in the fetus and embryo. {ECO:0000269|PubMed:1397691}.
Protein families：Krueppel C2H2-type zinc-finger protein family