SG3A2_MOUSE Q920H1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q920H1
Recommended name：Secretoglobin family 3A member 2
EC number：
Alternative names：(Pneumo secretory protein 1) (PnSP-1) (Uteroglobin-related protein 1)
Cleaved into：
GeneID：117158
Gene names (primary )：Scgb3a2
Gene names (synonym )：Pnsp1 Ugrp1
Gene names (ORF )：
Length：91
Mass：9819
Sequence：MKLVSIFLLVTIGICGYSATALLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLEALSHLV
Tissue specificity：Highly expressed in lung where it localizes to epithelial cells of the trachea, bronchus and bronchioles (at protein level) (PubMed:11682631, PubMed:12406855, PubMed:12175512, PubMed:25242865). Expressed in club/Clara cells of the bronchioles (PubMed:12406855). Also detected in the anterior and posterior lobes of the pituitary gland where it may localize to gonadotropic cells (at protein level) (PubMed:24514953). Not detected in other tissues tested (PubMed:11682631, PubMed:12175512). {ECO:0000269|PubMed:11682631, ECO:0000269|PubMed:12175512, ECO:0000269|PubMed:12406855, ECO:0000269|PubMed:24514953, ECO:0000269|PubMed:25242865}.
Induction：
Developmental stage：Detected in the pituitary gland from postnatal day 1 onwards (at protein level) (PubMed:24514953). Weakly expressed in embryonic lung at stages 11.5 dpc and 12.5 dpc (PubMed:11682631, PubMed:18535256). Seems to localize most strongly to the growing tips of bronchi at stage 13.5 dpc (PubMed:18535256). Highly expressed in developing lung at stages 16.5 dpc and 18.5 dpc, where it localizes to airway epithelia (PubMed:11682631, PubMed:12406855, PubMed:12175512, PubMed:24514953). During gestation, detected in the mammary gland at 6.5 days post coitum (dpc), but expression declines at 8.5 dpc and is absent at later stages (PubMed:12175512). {ECO:0000269|PubMed:11682631, ECO:0000269|PubMed:12175512, ECO:0000269|PubMed:12406855, ECO:0000269|PubMed:18535256, ECO:0000269|PubMed:24514953}.
Protein families：Secretoglobin family, UGRP subfamily