LCFC1_MOUSE   Q9D9P8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D9P8

Recommended name:Sperm-egg fusion protein LLCFC1

EC number:

Alternative names:(LLLL and CFNLAS motif-containing protein 1) (MSSP-binding protein CTM-1) (Sperm-oocyte fusion required protein 1)

Cleaved into:

GeneID:76606

Gene names  (primary ):Llcfc1

Gene names  (synonym ):Sof1

Gene names  (ORF ):

Length:108

Mass:12138

Sequence:MTSLGSQLHRATFLTALLLLLLLQVKGVKTLIVSASLDGDKSQKDKVSSEDQGEEEYEEHFEASSEGEQWQEIDMVQQEDTISQAITLQDHLLDLAFCFNLASIMFFL

Tissue specificity:Detected in testicular germ cells and spermatozoa (at protein level). Abundantly expressed in testis. {ECO:0000269|PubMed:32393636}.

Induction:

Developmental stage:Detected in the testis after postnatal day 28. {ECO:0000269|PubMed:32393636}.

Protein families:


   💬 WhatsApp