S6A15_MOUSE Q8BG16
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BG16
Recommended name：Sodium-dependent neutral amino acid transporter B(0)AT2
EC number：
Alternative names：(Sodium- and chloride-dependent neurotransmitter transporter NTT73) (Solute carrier family 6 member 15) (Transporter v7-3)
Cleaved into：
GeneID：103098
Gene names (primary )：Slc6a15
Gene names (synonym )：B0at2 Ntt73
Gene names (ORF )：
Length：729
Mass：81792
Sequence：MPKNSKVVKRDLDDDVIESVKDLLSNEDSVEEVSKKSELIVDVQEEKDTDAEDGSEADDERPAWNSKLQYILAQVGFSVGLGNVWRFPYLCQKNGGGAYLLPYLILLLVIGIPLFFLELSVGQRIRRGSIGVWNYISPKLGGIGFASCVVCYFVALYYNVIIGWTLFYFSQSFQQPLPWDQCPLVKNASHTYVEPECEQSSATTYYWYREALDITSSISDSGGLNWKMTVCLLVAWVMVCLAMIKGIQSSGKIMYFSSLFPYVVLICFLIRSLLLNGSIDGIRHMFTPKLEMMLEPKVWREAATQVFFALGLGFGGVIAFSSYNKRDNNCHFDAVLVSFINFFTSVLATLVVFAVLGFKANIVNEKCISQNSEMILKLLKMGNISWDVIPHHINLSAVTVEDYRLVYDIIQKVKEEEFAVLHLNACQIEDELNKAVQGTGLAFIAFTEAMTHFPASPFWSVMFFLMLINLGLGSMFGTIEGIITPIVDTFKVRKEILTVICCLLAFCIGLIFVQRSGNYFVTMFDDYSATLPLLIVVILENIAVSFVYGIDKFIEDLTDMLGFAPSKYYYYMWKYISPLMLLTLLIASIVNMGLSPPGYNAWIKEKASEEFLSYPMWGMVVCFSLMVLAILPVPVVFIIRRCNLIDDSSGNLASVTYKRGRVLKEPVNLEGDDASLIHGKIPSEMSSPNFGKNIYRKQSGSPTLDTAPNGRYGIGYLMADMPDMPESDL
Tissue specificity：Significant expressed in brain, lung and kidney. regions, the cortex, the cerebellum and the brain stem. {ECO:0000269|PubMed:16185194}.
Induction：
Developmental stage：Detected throughout development, starting with the pre-implantation embryo. {ECO:0000269|PubMed:16185194}.
Protein families：Sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family, SLC6A15 subfamily