PLPP3_MOUSE Q99JY8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99JY8
Recommended name:Phospholipid phosphatase 3
EC number:EC 3.1.3.-
Alternative names:(Lipid phosphate phosphohydrolase 3) (PAP2-beta) (Phosphatidate phosphohydrolase type 2b) (Phosphatidic acid phosphatase 2b) (PAP-2b) (PAP2b)
Cleaved into:
GeneID:67916
Gene names (primary ):Plpp3
Gene names (synonym ):Lpp3 Ppap2b
Gene names (ORF ):
Length:312
Mass:35216
Sequence:MQSYKYDKAIVPESKNGGSPALNNNPRKGGSKRVLLICLDLFCLFMAALPFLIIETSTIKPYRRGFYCNDESIKYPLKVSETINDAVLCAVGIVIAILAIITGEFYRIYYLKEKSRSTTQNPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCDPDFSQINCSEGYIQNYRCRGEDSKVQEARKSFFSGHASFSMFTMLYLVLYLQARFTWRGARLLRPLLQFTLLMMAFYTGLSRVSDYKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTSLSLPAPAIRREILSPVDIIDRNNHHNMV
Tissue specificity:Detected in lung, cerebellum and heart atrium. {ECO:0000269|PubMed:12925589, ECO:0000269|PubMed:21319224}.
Induction:
Developmental stage:Display a characteristic dynamic and changing pattern of expression throughout the life cycle of the mouse (PubMed:12925589). Expression during early stages of development is specific of structures where multiple inductive interactions occur such as the limb buds, mammary gland primordia, heart cushions and valves among others (PubMed:19123136). Detected in a few cells of the extra-embryonic ectoderm of E6.5 embryos. By E7.5, starts to be strongly expressed in the anterior visceral endoderm, as well as in the extra-embryonic membranes. By E8.0 expression extends to a highly localized region around the node and appears at the tip of the allantois. At E8.5 predominantly expressed in the allantois, the developing gut, the pericardio-peritoneal canal and somites. In E9.5 embryos persists in the umbilical cord, and is also found in the chorionic region. In later mid-gestation embryos, present at high levels in the apical ectodermal ridge and mesenchyme of the limb buds, in the peripheral nervous system, cranial nerves, and mammary gland primordia (PubMed:12925589). {ECO:0000269|PubMed:12925589, ECO:0000269|PubMed:19123136}.
Protein families:PA-phosphatase related phosphoesterase family