NP1L1_MOUSE P28656
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P28656
Recommended name：Nucleosome assembly protein 1-like 1
EC number：
Alternative names：(Brain protein DN38) (NAP-1-related protein)
Cleaved into：
GeneID：53605
Gene names (primary )：Nap1l1
Gene names (synonym )：Nrp
Gene names (ORF )：
Length：391
Mass：45345
Sequence：MADIDNKEQSELDQDLEDVEEVEEEETGEETKIKARQLTVQMMQNPQILAALQERLDGLVDTPTGYIESLPKVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEVSEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNDYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPENGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ
Tissue specificity：Highly expressed in the brain (at protein level) (PubMed:29490266). High expression in cerebral cortex, not in cerebellar cortex. {ECO:0000269|PubMed:29490266}.
Induction：
Developmental stage：During brain development, expression decreases from 12 dpc to P0. Expressed predominantly but not restricted in the ventricular zone (VZ)/subventricular zone (SVZ), and peak expression is observed at 12.5 dpc, in which the cerebral cortex consists primarily of neural progenitor cells (NPCs). At 15.5 dpc, the expression decreases in the cerebral cortical plate. At 18.5 dpc, when the embryonic neurogenesis period nears its end, the expression throughout the cerebral cortex is lower than that at 12.5 dpc (at protein level). {ECO:0000269|PubMed:29490266}.
Protein families：Nucleosome assembly protein (NAP) family