NR1D1_MOUSE Q3UV55
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3UV55
Recommended name:Nuclear receptor subfamily 1 group D member 1
EC number:
Alternative names:(Rev-erbA-alpha) (V-erbA-related protein 1) (EAR-1)
Cleaved into:
GeneID:217166
Gene names (primary ):Nr1d1
Gene names (synonym ):Ear1
Gene names (ORF ):
Length:615
Mass:66802
Sequence:MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDSSNGSFQSLTQGCPTYFPPSPTGSLTQDPARSFGSAPPSLSDDSSPSSASSSSSSSSSSFYNGSPPGSLQVAMEDSSRVSPSKGTSNITKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRINRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLAEMQSAMNLANNQLSSLCPLETSPTPHPTSGSMGPSPPPAPAPTPLVGFSQFPQQLTPPRSPSPEPTMEDVISQVARAHREIFTYAHDKLGTSPGNFNANHASGSPSATTPHRWESQGCPSAPNDNNLLAAQRHNEALNGLRQGPSSYPPTWPSGPTHHSCHQPNSNGHRLCPTHVYSAPEGEAPANSLRQGNTKNVLLACPMNMYPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVLMVRFASLFNVKDQTVMFLSRTTYSLQELGAMGMGDLLNAMFDFSEKLNSLALTEEELGLFTAVVLVSADRSGMENSASVEQLQETLLRALRALVLKNRPSETSRFTKLLLKLPDLRTLNNMHSEKLLSFRVDAQ
Tissue specificity:Expressed during adipocyte differentiation (at protein level). Expressed in skeletal muscle, bladder, lumbar spinal cord, pancreatic islets and hypothalamus. Expressed in developing and adult retina. In the adult retina, predominantly expressed in the outer nuclear layer, where rod and cone cells reside, and also localized to the ganglion cell layer. Expressed in a circadian manner in the liver (PubMed:27686098). Expressed in a circadian manner in the lung with a peak between ZT8 and ZT12 (PubMed:29533925). {ECO:0000269|PubMed:18227153, ECO:0000269|PubMed:18454201, ECO:0000269|PubMed:21408158, ECO:0000269|PubMed:21874017, ECO:0000269|PubMed:22166979, ECO:0000269|PubMed:23531614, ECO:0000269|PubMed:24603368, ECO:0000269|PubMed:27686098, ECO:0000269|PubMed:29533925}.
Induction:Expression oscillates diurnally in the suprachiasmatic nucleus (SCN) of the hypothalamus as well as in peripheral tissues. In bladder smooth muscle cells, pancreas and lumbar spinal cord, exhibits night/day variations with a peak time at circadian time (CT) 4-12 and a trough at CT16-24. {ECO:0000269|PubMed:14645221, ECO:0000269|PubMed:22549838, ECO:0000269|PubMed:23531614, ECO:0000269|PubMed:24603368}.
Developmental stage:During development at embryonic day 18.5 dpc, expressed in the outer neuroblastic layer of the retina where developing postmitotic photoreceptors and retinal progenitors reside (at protein level). {ECO:0000269|PubMed:21408158}.
Protein families:Nuclear hormone receptor family, NR1 subfamily