GLRX2_MOUSE   Q923X4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q923X4

Recommended name:Glutaredoxin-2, mitochondrial

EC number:

Alternative names:

Cleaved into:

GeneID:69367

Gene names  (primary ):Glrx2

Gene names  (synonym ):Grx2

Gene names  (ORF ):

Length:156

Mass:17307

Sequence:MSWRRAASVGRRLVASGRILAGRRGAAGAAGSGMGNSTSSFWGKSTTTPVNQIQETISNNCVVIFSKTSCSYCSMAKKIFHDMNVNYKAVELDMLEYGNQFQDALHKMTGERTVPRIFVNGRFIGGAADTHRLHKEGKLLPLVHQCYLKKKQEERH

Tissue specificity:Widely expressed. Highly expressed in testis, and at much lower level in kidney and brain. {ECO:0000269|PubMed:12954614}.

Induction:

Developmental stage:During development, it is expressed at highest level at 11 dpc. {ECO:0000269|PubMed:12954614}.

Protein families:Glutaredoxin family


   💬 WhatsApp