DBX1_MOUSE P52950
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P52950
Recommended name：Homeobox protein DBX1
EC number：
Alternative names：(Developing brain homeobox protein 1)
Cleaved into：
GeneID：13172
Gene names (primary )：Dbx1
Gene names (synonym )：Dbx
Gene names (ORF )：
Length：335
Mass：36334
Sequence：MMFPGLLAPPAGYPSLLRPTPTLTLPQSLQSAFSGHSSFLVEDLIRISRPPTYLSRSIPAASLSPPSQEAPAALADSGTSDLGSPGSGSRRGSSPQTALSPASEPTFLKFGVNAILSSAPRRETSPALLQSPPPKTFAFPYFEGSFQPFIRSSYFPASSSVVPIPGTFSWPLAARGKPRRGMLRRAVFSDVQRKALEKTFQKQKYISKPDRKKLASKLGLKDSQVKIWFQNRRMKWRNSKERELLSSGGCREQTLPTKLNPHPDLSDVGQKGPGDEEEDNPGARLAYHAPADPRHLLEGPLPASPAHSSSPGKPSDFSDSDEDEEGEEDEEITVS
Tissue specificity：
Induction：
Developmental stage：During early and mid-gestation, dbx expression is restricted to the telencephalon, diencephalon, dorsal mesencephalon and spinal cord. At later gestational stages, dbx expression continues in the dorsal mesencephalon and diencephalon, in which expression is more restricted than at the earlier stages.
Protein families：H2.0 homeobox family