OSR1_MOUSE Q9WVG7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9WVG7
Recommended name：Protein odd-skipped-related 1
EC number：
Alternative names：
Cleaved into：
GeneID：23967
Gene names (primary )：Osr1
Gene names (synonym )：Odd1
Gene names (ORF )：
Length：266
Mass：29584
Sequence：MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFSKVPGAVSSLMDARFQLPAFPWFPHVIHPKPEITAGGSGAALKTKPRFDFANLALAATQEDPTKLGRGEGPGSPAGGLGALLDVTKLSPEKKPTRGRLPSKTKKEFVCKFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHSQVKELKTSKIKC
Tissue specificity：
Induction：Transcriptionally regulated by Ikzf1 and Runx2. {ECO:0000269|PubMed:18804520}.
Developmental stage：During early embryogenesis it is expressed in the intermediate mesoderm and in a dynamic pattern during limb and branchial arch development. Is expressed from the earliest stage of intermediate development. Is expressed in the dorsal atrial wall, including the developing primary atrial septum and the venous valve. {ECO:0000269|PubMed:16223478}.
Protein families：Odd C2H2-type zinc-finger protein family