SPR2G_MOUSE   O70558


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O70558

Recommended name:Small proline-rich protein 2G

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):Sprr2g

Gene names  (synonym ):

Gene names  (ORF ):

Length:76

Mass:8296

Sequence:MSFQEQQCKQPCQPPPVCPPPKCPEPCPLPKCPEPCPPPKCPEPCPEPCLPSPCQQKCPPVQTPPPCQQKCPPKSK

Tissue specificity:Expressed in uterus. {ECO:0000269|PubMed:15232223}.

Induction:Up-regulated by estrogen in the uterus of ovariectomized animals, with strongly increased expression detected in luminal epithelial cells at 6 and 12 hours after hormone injection. {ECO:0000269|PubMed:15232223}.

Developmental stage:During early pregnancy, moderate uterine expression is detected from 1 dpc to 5 dpc, with levels decreasing at 6 dpc. {ECO:0000269|PubMed:15232223}.

Protein families:Cornifin (SPRR) family


   💬 WhatsApp