FNDC4_MOUSE Q3TR08
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3TR08
Recommended name：Fibronectin type III domain-containing protein 4
EC number：
Alternative names：(Fibronectin type III repeat-containing protein 1)
Cleaved into：
GeneID：64339
Gene names (primary )：Fndc4
Gene names (synonym )：Fnmp1 Frcp1
Gene names (ORF )：
Length：231
Mass：24933
Sequence：MPLAPPANSVETMASLMPLSPYLSPTVLLLVSCDLGFVRADRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGPEQSPQGRPVGTTRQKKSPSINTIDV
Tissue specificity：Highly expressed in adult liver and brain tissues. {ECO:0000269|PubMed:12384288}.
Induction：Up-regulated in the context of tissue inflammation. {ECO:0000269|PubMed:27066907}.
Developmental stage：During embryo development, expressed in the brain. {ECO:0000269|PubMed:12384288}.
Protein families：