NKX32_MOUSE P97503
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P97503
Recommended name：Homeobox protein Nkx-3.2
EC number：
Alternative names：(Bagpipe homeobox protein homolog 1) (Homeobox protein NK-3 homolog B)
Cleaved into：
GeneID：12020
Gene names (primary )：Nkx3-2
Gene names (synonym )：Bapx1 Nkx-3.2 Nkx3b
Gene names (ORF )：
Length：333
Mass：35167
Sequence：MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSLLASPARTRTAVGQSAESPGGWDSDSALSEENEGRRRCADVPGASGTGRARVTLGLDQPGCELHAAKDLEEEAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVPGLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ
Tissue specificity：Expressed widely in mesoderm at the gastroduodenal junction (at protein level). Expressed in visceral mesoderm and embryonic skeleton. Expression is restricted to immature proliferative chondrocytes during endochondral ossification. {ECO:0000269|PubMed:16421188, ECO:0000269|PubMed:19208343}.
Induction：
Developmental stage：During embryogenesis, expressed in a discrete domain within the mandibular component of the first branchial arch and later in the primordia of middle earassociated bones, the gonium and tympanic ring. {ECO:0000269|PubMed:14973294}.
Protein families：NK-3 homeobox family